PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG680100.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 193aa    MW: 21886.2 Da    PI: 10.2511
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG680100.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.65.1e-31959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien++nrqvtf+kRrng+lKKA+ELS+LCdae+a++ifss+g+lyeys+
  Pavir.5KG680100.4.p  9 KRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEIALVIFSSRGRLYEYST 59
                         79***********************************************96 PP

2K-box92.95.4e-3183168994
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                           + + +++ qqe+akL ++i++Lq++++hl+Ge++++++ keL+++e++Le+++ +iRskK+e+ll++ie++qk+  + +++ ++L
  Pavir.5KG680100.4.p  83 IDVNSHQYFQQEAAKLHQQIQTLQNSNKHLMGESIGNMTAKELRSIESRLERGIGRIRSKKHEMLLAEIEYMQKRVSSYSSDRQTL 168
                          566889**********************************************************************9999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.7E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.894161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.18E-32274IPR002100Transcription factor, MADS-box
CDDcd002651.33E-44275No hitNo description
PRINTSPR004041.2E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-323859IPR002100Transcription factor, MADS-box
PfamPF014866.0E-2485168IPR002487Transcription factor, K-box
PROSITE profilePS5129711.99988178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSILCD AEIALVIFSS RGRLYEYSTN  60
SVRSTIERYK KASASTSGTA PVIDVNSHQY FQQEAAKLHQ QIQTLQNSNK HLMGESIGNM  120
TAKELRSIES RLERGIGRIR SKKHEMLLAE IEYMQKRVSS YSSDRQTLGA VVTWTNSELF  180
IIAIDIPPVL FI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-21173173Myocyte-specific enhancer factor 2B
1tqe_R1e-21173173Myocyte-specific enhancer factor 2B
1tqe_Q1e-21173173Myocyte-specific enhancer factor 2B
1tqe_P1e-21173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0621101e-162BT062110.1 Zea mays full-length cDNA clone ZM_BFb0215E12 mRNA, complete cds.
GenBankKJ7269311e-162KJ726931.1 Zea mays clone pUT3477 MADS transcription factor (MADS41) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970830.11e-108PREDICTED: MADS-box transcription factor 21
RefseqXP_004970831.11e-108PREDICTED: MADS-box transcription factor 21
SwissprotQ8RU318e-98MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLK3XKX81e-108K3XKX8_SETIT; Uncharacterized protein
STRINGSi002551m1e-108(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-84MIKC_MADS family protein